PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000299774
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family HB-other
Protein Properties Length: 223aa    MW: 25004.7 Da    PI: 10.7466
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000299774genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.45.7e-09156203653
                    S--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHH CS
       Homeobox   6 tftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRa 53 
                    +++k q+e+Le +++k++ p+ ++   + + ++L+ ++V  WF  +R 
  MDP0000299774 156 RLKKAQVETLEGVYRKTKRPTNAMVSSMVHVTNLPRKRVVKWFEDKRS 203
                    6789****************************************9996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500719.831148208IPR001356Homeobox domain
SuperFamilySSF466896.84E-9154205IPR009057Homeodomain-like
CDDcd000865.29E-6154202No hitNo description
SMARTSM003898.8E-4154212IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.607.5E-9155213IPR009057Homeodomain-like
PfamPF000461.7E-6156203IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 223 aa     Download sequence    Send to blast
MAFASALDTP KGLHFLPLPS SSRHERSPTN LVLPRHFPTR FSSTIALARR RNHRAEVAPS  60
RTKIKKIKTL AAELCLDRAV VLELLREPPP SLLIMCVTLP DEPATVVSVS QPNSVETVVE  120
TTGETVVETT TDSVELESAA KVPVHARQQK FSAQKRLKKA QVETLEGVYR KTKRPTNAMV  180
SSMVHVTNLP RKRVVKWFED KRSEDXVPDS RQPYQRPIPN TVL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008352054.11e-90PREDICTED: nonsense-mediated mRNA decay protein 2-like
SwissprotQ8H0V52e-52OCP3_ARATH; Protein OVEREXPRESSOR OF CATIONIC PEROXIDASE 3
TrEMBLM5XCV91e-62M5XCV9_PRUPE; Uncharacterized protein
STRINGVIT_04s0008g05190.t018e-59(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF101813138
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11270.14e-39overexpressor of cationic peroxidase 3